Francais | English | Espanõl

Enfuvirtide

From Wikipedia, the free encyclopedia

Jump to: navigation, search
Image:Enfuvirtide.png
Enfuvirtide
Systematic (IUPAC) name
YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF
Identifiers
CAS number 159519-65-0
ATC code J05AX07
PubChem  ?
DrugBank BTD00106
Chemical data
Formula C202H298N50O64 
Mol. weight 4450.8 g/mol
Pharmacokinetic data
Bioavailability 84.3% (SC)
Protein binding 92%
Metabolism Hepatic
Half life 3.8 hours
Excretion unknown
Therapeutic considerations
Pregnancy cat.

B2 (Au), B (U.S.)

Legal status

S4 (Au), POM (UK), ℞-only (U.S.)

Routes Subcutaneous (SC)

Enfuvirtide (INN) is an HIV fusion inhibitor, the first of a novel class of antiretroviral drugs used in combination therapy for the treatment of HIV-1 infection. It is marketed under the trade name Fuzeon (Roche).

Enfuvirtide therapy costs an estimated USD$25,000 per year in the United States. Its cost and inconvenient dosing regimen are factors behind its use as a reserve, for "salvage" therapy in patients with multi-drug resistant HIV.

Contents

[edit] History

Enfuvirtide originated at Duke University, where researchers formed a pharmaceutical company known as Trimeris. Trimeris began development on enfuvirtide in 1996 and initially designated it T-20. In 1999, Trimeris entered into partnership with Hoffmann-La Roche to complete the development of the drug. It was approved by the U.S. Food and Drug Administration (FDA) on March 13, 2003 as the first HIV fusion inhibitor, a new class of antiretroviral drugs. It was approved on the basis of two studies (TORO 1 and TORO 2) which compared the effect of optimized regimens of antiretroviral medication with and without the addition of enfuvirtide on serum viral load.

[edit] Pharmacology

[edit] Mechanism of action

Enfuvirtide works by disrupting the HIV-1 molecular machinery at the final stage of fusion with the target cell, preventing uninfected cells from becoming infected. A biomimetic peptide, enfuvirtide was rationally designed to mimic components of the HIV-1 fusion machinery and displace them, preventing normal fusion. Drugs that disrupt fusion of virus and target cell are termed entry inhibitors or Fusion inhibitors. HIV binds to host cell receptor CD4+ by the protein GP120, upon binding GP120 deforms allowing the viral protein GP41 to inbed it'self into the host cell's plasma membrane, entry inhibitors bind to GP41 preventing the creation of an entry pore for the capsid of the virus keeping it out of the cell. [1]

[edit] Microbiology

Enfuvirtide is considered to be active against HIV-1 only. Low activity against HIV-2 isolates has been demonstrated in vitro.<ref name="FuzeonPI">Roche Products Pty Ltd. Fuzeon (Australian Approved Product Information). Dee Why (NSW): Roche; 2005.</ref>

Variable susceptibility to enfuvirtide has been observed in clinical isolates, with acquired resistance the result of a mutated 10 amino acid motif in viral gp41. Primary resistance, however, has yet to be observed.<ref name="Greenberg2004">Greenberg ML, Cammack N. Resistance to enfuvirtide, the first HIV fusion inhibitor. J Antimicrob Chemother 2004;54(2):333-40. PMID 15231762</ref>

[edit] Clinical use

[edit] Indications

Enfuvirtide is indicated for the treatment of HIV-1 infection, in combination therapy with other antiretrovirals, in patients where all other treatments have failed.<ref name="AMH2006">Rossi S, editor. Australian Medicines Handbook 2006. Adelaide: Australian Medicines Handbook; 2006. ISBN 0-9757919-2-3</ref>

[edit] Dosage forms

By virtue of its peptide nature, enfuvirtide is marketed in injectable form. The lyophilised enfuvirtide powder must be reconstituted by the patient and administered twice daily by subcutaneous injection.

[edit] Adverse effects

Common adverse drug reactions (≥1% of patients) associated with enfuvirtide therapy include: injection site reactions (pain, hardening of skin, erythema, nodules, cysts, itch; experienced by nearly all patients, particularly in the first week), peripheral neuropathy, insomnia, depression, cough, dyspnoea, anorexia, arthralgia, infections (including bacterial pneumonia) and/or eosinophilia. Various hypersensitivity reactions occur infrequently (0.1–1% of patients), symptoms of which include rash, fever, nausea, vomiting, chills, rigors, hypotension, elevated hepatic transaminases; and possibly more severe reactions including respiratory distress, glomerulonephritis and/or anaphylaxis – rechallenge is not recommended.<ref name="AMH2006" />

[edit] References

<references />


Antivirals (primarily J05A, also S01AD and D06BB) edit
Anti-herpesvirus agents   Aciclovir, Cidofovir, Docosanol, Famciclovir, Fomivirsen, Foscarnet, Ganciclovir, Idoxuridine, Penciclovir, Trifluridine, Tromantadine, Valaciclovir, Valganciclovir, Vidarabine
Anti-influenza agents Amantadine, Oseltamivir, Peramivir, Rimantadine, Zanamivir
 
Antiretroviral drugs   NRTIs Abacavir, Didanosine, Emtricitabine, Lamivudine, Stavudine, Zalcitabine, Zidovudine
NtRTIs   Tenofovir
NNRTIs   Efavirenz, Delavirdine, Nevirapine
PIs Amprenavir, Atazanavir, Darunavir, Fosamprenavir, Indinavir, Lopinavir, Nelfinavir, Ritonavir, Saquinavir, Tipranavir
Fusion inhibitors Enfuvirtide
 
Other antiviral agents Adefovir, Fomivirsen, Imiquimod, Inosine,Interferon, Podophyllotoxin, Ribavirin, Viramidine
Personal tools